PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0537s0005.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 189aa    MW: 20581.6 Da    PI: 8.6318
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0537s0005.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.41e-20132180251
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                          p+l+Wt++LH++F+ a++ L G ekA Pk+i e+m+v gLt+++v SHLQ
  Kalax.0537s0005.1.p 132 PKLVWTTQLHNKFLCALDIL-GLEKAQPKKIHEVMNVAGLTRANVVSHLQ 180
                          89******************.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.377139IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.2E-4142No hitNo description
Gene3DG3DSA:1.10.10.602.8E-19130180IPR009057Homeodomain-like
SuperFamilySSF466891.63E-13130182IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-18131181IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSADDKTHTL LRGLNGGAVL YMHKPVSTAE LKNIWQFIYR YSGKAIMNDH TEIFSEDVGG  60
SSCGSSTPGD PHFIAVSGAA TQLWKGNSNA AEDPLKMYNT RCVQHANGMQ IREAIVNNNA  120
PLPVVPRTGN NPKLVWTTQL HNKFLCALDI LGLEKAQPKK IHEVMNVAGL TRANVVSHLQ  180
VMCPYTIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-15130180454ARR10-B
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-24response regulator 2